McDonnell Genome Institute

Washington University

CircRNA

chr16|64998561|64998856|-|CDH11|ENST00000268603.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9675

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

TLMTTLR

Amino Acids from 5' Exons

LHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNV,FIQILTLVMGTLNTFSQGKELEPFLLMTNQGTFMPPRRWIEKREPSTRWLRRWTGTPIGHWSHRRNSLSRSRTLMTTLRSSCTRPIMPTCLRGPMW,SFRYLWWEHIHSLRGRSWNHFCDQIREHSCHQDVGSRRESPVHVDGSGGGQGHQSATGATVGIHCQGPGHQPSGVPARDLSCQRAEVQC

Amino Acids from 3' Exons

LHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNV,FIQILTLVMGTLNTFSQGKELEPFLLMTNQGTFMPPRRWIEKREPSTRWLRRWTGTPIGHWSHRRNSLSRSRTLMTTLRSSCTRPIMPTCLRGPMW,SFRYLWWEHIHSLRGRSWNHFCDQIREHSCHQDVGSRRESPVHVDGSGGGQGHQSATGATVGIHCQGPGHQPSGVPARDLSCQRAEVQC