McDonnell Genome Institute

Washington University

CircRNA

chr16|61713840|61727215|-|CDH8|ENST00000299345.10

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9967

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

YHEYLLLLK

Amino Acids from 5' Exons

VIQTVSAMDKDDPKNGHYFLYSLLPEMVNNPNFTIKKNE,SFKLLAPWTKMIPKTDIISYTVSFQKWSTIRISPSRKMK,HSNCRHGQRSQKRTLFLIQSPSRNGQQSEFHHQEK

Amino Acids from 3' Exons

GTTVRYHEYLLLLKCWMSMTTPLNSHPNMRHFYVKMENPA,EPQSDITSTCCYSAGCQQRPIRIRIGIFMKWKTRP,NHSQISRVPVAIKVLDVNDNAPEFASEYEAFLCENGKPGQ