McDonnell Genome Institute

Washington University

CircRNA

chr16|58709416|58716813|-|GOT2|ENST00000245206.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9939

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

26

2

Peptide

EGSTHNWQHITDQIGMFCFTGLKPEQKR

Amino Acids from 5' Exons

AARSESHGPHHWHADSTGLQPQEGGFHPQLATHHRPNWHVLFHRAKAT,LQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQ,CKKKSWLTASLACGLNWSPTSRRRVPPTIGNTSPTKLACSVSQGSLN

Amino Acids from 3' Exons

KRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLY,KGISLRSLTWPTKALPVVMVIRMPGLCATSSNRALMFASANHMPRTWAYM,KESLCVLHGLPRLCQWWGCLGCAPLHRTGHCLPLPIICQEHGLI