McDonnell Genome Institute

Washington University

CircRNA

chr16|58581344|58582903|-|CNOT1|ENST00000317147.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9968

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

14

Peptide

HAEGQSISAPGSGIWSDGK

Amino Acids from 5' Exons

NPSLNFKEVTYELDHPGFQIRDSKGLHNVVYGIQRGLGMEVFPVDLIYRPWKHAEGQ,IQVISRKLMNWTILDFKFVTVKDFIMWFMAFRGVWVWKCSQTSYIDLGNMLKA,SKFEFQGSNLTGPSWISNSQRTSCGLWHSEGFGYGSVPSRPHITLETCRP

Amino Acids from 3' Exons

SISAPGSGIWSDGKDKSDGAQAHTWNVEVLIDVLKEL,VFLLRAVGSGVMGKIKVMEHRHTHGMKSLTFLKN,YFCSGQWDLEWERKWSTGTHMECRSLDRSRT