McDonnell Genome Institute

Washington University

CircRNA

chr16|58534146|58537220|-|CNOT1|ENST00000568917.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

AFSAFVGQVELLER

Amino Acids from 5' Exons

MHQQGILKTDDLITRFFRLCTEMCVEISYRAQAEQQHNPAANPTMIRAKCYHNLDAFVRLIALLVKHSGEATNTVTKINLLNK,CTSKEYRPMISQGSFVCVLKCVLKSVTVLRLSSSTILLPIPPSEPSAITTWMPLFDSLHCSNTQGRPPTLSQRLICT,APARNTEDRSHNKVLSSVYNVCNQLPCSGAAAQSCCQSHHDPSQVLSQPGCLCSTHCTARETLRGGHQHCHKDSAEQ

Amino Acids from 3' Exons

IAPADGSSAIQLSNDSCSWRPKLYDAFWDLSSLRVPSRPEGEGRVSSEGMGESLPFSSSWPRQYQSFLCICWTGRAFGKK,LPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVGQVELLERK,CPSWKCDPTMKQLIVLMEAQTLCILGSLKPQSMMTLQAGRRQSIFGNGISTIQQQLAATVPKLSLHLLDRSFWKE