McDonnell Genome Institute

Washington University

CircRNA

chr16|57172775|57173869|-|FAM192A|ENST00000309137.12

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9378

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

MTLDLYMK

Amino Acids from 5' Exons

NVQRRFMTLDLYMKGYRNRRTGSSRSTRNSSNS,MSRGGLPSISIKATGTEGQEAAGVRGTVQI,CPEEVYDPRSLYERLQEQKDRKQQEYEEQFKF

Amino Acids from 3' Exons

IGCFIMDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPE,LVVSLWMEGMMVTLLSKRGLCLRQNMNGAKGGKKNGRKFENLKIQK,WLFHYGWRGWPYYQKEVCVGRTRTAQKEARRMGESSKTRSR