McDonnell Genome Institute

Washington University

CircRNA

chr16|53464225|53481835|+|RBL2|ENST00000262133.10

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9968

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

FSITSATVLQR

Amino Acids from 5' Exons

GILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYK,VFWNKMRSTDLSWPAALRSSLFLISLLGIFHLLLKYLMCLFIIFI,YSGTRCVPQISLGLLPGRHFFLASWEFSIYYNICASLSFL

Amino Acids from 3' Exons

MDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNSPSK,WMLLHSLPIHLEQAPLAEYSCLKIILSTFPHIKMKQCFLLEKRFSITSATVLQ,GCSSTLSLSICKNRLPSPNTVVSKSSCLHFPTKNNAFSSRKDFLLLQQQSFK