McDonnell Genome Institute

Washington University

CircRNA

chr16|53286225|53308854|+|CHD9|ENST00000219084.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9821

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

SIPVSGYEK

Amino Acids from 5' Exons

DMKNITLFEQTQHYASWKEWENLMRKQLLLNRERMIIWM,IKIHYSSRPSIMLLGKSGKTESSCCTESELYGW,YEKYNTIRADPALCFLERVGKPDEKAVAAEQRANDYMD

Amino Acids from 3' Exons

EGGLKLTFQKQGLAQKRPFDGEDGALGQQQYLTRLRELQSASETSLVNFPKSIPVS,KVVSHFRSKGLLRKDHLMVKTVLWGSSSTSLGFESFKVHQRPASSISQNPYQYQ,RWFEVDISEARACSEKTIWRRCSGAAAVPHSASRASKCIRDQPRQFPKIHTSI