McDonnell Genome Institute

Washington University

CircRNA

chr16|48347506|48351685|+|LONP2|ENST00000565867.2

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9567

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

8

Peptide

DLEGIPGNVSQR

Amino Acids from 5' Exons

VSQRLSQPGVAIGLAWTPLGGEIMFVEASRMDGEGQLTLTGQLGDVMKESAHLAISWLRSNAKKYQLTN,YLSVVSQEQVWLGLPVEKSCSWRRVEWMARASLPASSGTRSPPTSLSAGSAATQRSTSPM,ISAFESARSSNRFGLDSLRWRNHVRGGESNGWRGPVNSDRPARGRDEGVRPPRYQLAPQQRKEVPADQ

Amino Acids from 3' Exons

VGGIKDKVLAAHRAGLKQVIIPRRNEKDLEGIPGN,WVELKTKCWRHTERDSKSLFLGEMKKTLRESQA,GWNRQSAGGTQSGTEASHYSSEKKRPGNPRQ