McDonnell Genome Institute

Washington University

CircRNA

chr16|48256609|48334358|+|LONP2|ENST00000285737.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9707

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

11

Peptide

DILGPPMYEMELVEMLDMSVPAVAK

Amino Acids from 5' Exons

LVEMLDMSVPAVAKLRRLLDSLPREALPDILTSIIRTSNKEKLQ,WLKCWICLSLQLLNDVFIVFQGKLYQTSHQLSEQATKRNS,GNVGYVCPCSCIETSFRSSKGSFTRHLDINYPNKQQRETP

Amino Acids from 3' Exons

VAENTSKMKNLNLSVTLLTWLYHLKCRFLISMLKTSLGPRCMKW,LQRTHLRRKTIYQHYLGSTTNADFDFPCSERHPWAPDVNG,CREHILEDEKPESISDTTDLALPPEMPILIDFHALKDILGPPMYEME