McDonnell Genome Institute

Washington University

CircRNA

chr16|47665941|47669417|+|PHKB|ENST00000299167.12

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

2

Peptide

VVDSLAPSITNVLVQGK

Amino Acids from 5' Exons

VGCTPCSKSFKSSGQPGPIHYCFSAGQT,SVVRRAASLLSKVVDSLAPSITNVLVQGKQ,RLYAVQQVFVKWTAWPHPLLMFCRAN

Amino Acids from 3' Exons

VTLGAFGHEEEVISNPLSPRVIQNIIYYKCNTHDEREAVIQQELVIHIGWIISNNPELFSGMLKIRI,LWVPLGMKKKLSLILCLQEFKTSSIISVTPMMRGKRSFSKNWSSILAGSSPITLSYSVACKYES,NSGCLWARRSYLSFVSKSDSKHHLLVHPEGSGHSARTGHPYWLDHLQPVIQWHAENTNR