top of page

McDonnell Genome Institute

Washington University

CircRNA

chr16|46909683|46924544|+|GPT2|ENST00000340124.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9911

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

AVEAAQTILK

Amino Acids from 5' Exons

TILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPT,RSRSSSPGAASHGQVSPSHNIPSIQLSSLSSTPSRITTWTRRTAGRMMSSGGRCRRPKTTVILRCSASTLGTPQ,DPEDPRLRGRQVTDRCDDPHPTISPLFSCHLARRHPGELLPGRGELLGAECEAPAGGAGGQRPLSGALHNQPWEPH

Amino Acids from 3' Exons

EKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQ,RRSRSWVIWPKKQSRKTCLTKSQEFTATPCRGPCTPSLGSSFLPKLWRLL,EGVGPGSGQKSKADGRPVPSPRNSLQPLAGGHVRLPSDLHSCQSCGGCS

bottom of page