McDonnell Genome Institute

Washington University

CircRNA

chr16|4474092|4474792|-|NMRAL1|ENST00000574733.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9977

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

AQPPPSTHTR

Amino Acids from 5' Exons

SSPVASGEALHLAHFGLTGFTQTHCARAWGGQTRKRRRVPRDPGGANCAGGGVSADTSGLAAAARGPPTLGFRERRSARWGRSCGEGVGARAAPSPPLQWTRPQNRGPGLLELVPPRPRRGGHSSRWDPGRGAGDWNRGRREGGGDRAQGTRGGSRDPDISGQASCRSGPSRPLRHILDATMGVSFVAPGGNPGPTPNSTPPITPRSLDRIRPILVLMVDKKLVVVFGGT,HHPHPVKRLSTSLILVLDLHKLTVHVPGAGKPGNDAESRGIQEEPTAPEEGFRPTRRDWRLQPGVLRRWASVSGALPGGAGAAGRELAPSAQLHPRLCSGLGRRIGVPGSWNLSRPGRGEEVTPAGGTRAGGRVTGTGGGGKEEGIGPKGHEVGRGTPISRDRRLAAPGPAAPFDTYSMHRQWGCPLSLLAGTPAPPPTPRLPLPPDLWTGFVPFSSSWWTRNWWWFSEAQ,ITRSIRLRGSPPRSFWSNWIYTNSLCTCLGRANPETTPSPAGSRRSQLRRRRGFGRHVGIGGCSQGSSDAGLPAALCQVGPELRGGSWRLARSSIPASAVDSAAESGSRAPGTCPAQAAARRSLQPVGPGPGGGLEPGEAGRRRGSGPRDTRWVAGPRYLGTGVLPLRAQPPPSTHTRCIDNGGVLCRSWREPRPHPQLHASHYPQISGPDSSHSRPHGGQETGGGFRRH

Amino Acids from 3' Exons

SSPVASGEALHLAHFGLTGFTQTHCARAWGGQTRKRRRVPRDPGGANCAGGGVSADTSGLAAAARGPPTLGFRERRSARWGRSCGEGVGARAAPSPPLQWTRPQNRGPGLLELVPPRPRRGGHSSRWDPGRGAGDWNRGRREGGGDRAQGTRGGSRDPDISGQASCRSGPSRPLRHILDATMGVSFVAPGGNPGPTPNSTPPITPRSLDRIRPILVLMVDKKLVVVFGGT,HHPHPVKRLSTSLILVLDLHKLTVHVPGAGKPGNDAESRGIQEEPTAPEEGFRPTRRDWRLQPGVLRRWASVSGALPGGAGAAGRELAPSAQLHPRLCSGLGRRIGVPGSWNLSRPGRGEEVTPAGGTRAGGRVTGTGGGGKEEGIGPKGHEVGRGTPISRDRRLAAPGPAAPFDTYSMHRQWGCPLSLLAGTPAPPPTPRLPLPPDLWTGFVPFSSSWWTRNWWWFSEAQ,ITRSIRLRGSPPRSFWSNWIYTNSLCTCLGRANPETTPSPAGSRRSQLRRRRGFGRHVGIGGCSQGSSDAGLPAALCQVGPELRGGSWRLARSSIPASAVDSAAESGSRAPGTCPAQAAARRSLQPVGPGPGGGLEPGEAGRRRGSGPRDTRWVAGPRYLGTGVLPLRAQPPPSTHTRCIDNGGVLCRSWREPRPHPQLHASHYPQISGPDSSHSRPHGGQETGGGFRRH