McDonnell Genome Institute

Washington University

CircRNA

chr16|4260089|4262701|-|TFAP4|ENST00000204517.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

DSAGPGAADSAGDR

Amino Acids from 5' Exons

LLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQ,FCPLRPPPTTPRSCQHRLLLPPTTSMSSPWAPPRSSTLFPHPGKIWTPSC,SAPSGPHPPPHGDRASTASSSLPPHQCRHHGPLLGHQLCFHIPAKSGHHRA

Amino Acids from 3' Exons

PCQHSTNPRDSAGPGAADSAGDRQQQRAETHAEHQRGIPVPQDPHPPHRRREAQQ,LANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSK,LPTFHPPRLSGTRSGGFGGRSPTATSGDACRASTRDSSPSRPSSPTQTERSSA