McDonnell Genome Institute

Washington University

CircRNA

chr16|3397191|3397744|-|ZSCAN32|ENST00000396846.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

APGQQTSFK

Amino Acids from 5' Exons

TSFKVEPFFSAVSLYTCLTLSCPTDYRKTFLAGEHGFPVMWERWTLISRVEVATRVSQFVEANDGCSEEYRGTPILKQGSHTGPEISPPGQPLRGLPSALQAVLLPGGNWPTSFQTLGTLLSVAEAEDPLKRGNPGAAGFGAVSDYLARGDPDLGEGAASRKRRGSCGSGGCTESSWTT,HPSKLSPFFPLVSTHVHSHVPRITERHSLQENMASQCGKDGLSPGKWQPEASSLKQMMAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSEASRQRFRQFCYQEVTGPHEAFSKLWELCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPGQQ,ILQSALFFRCESLHMSDTLMSHGLQKDIPCRRTWLPSDVGKMDSDLQGRSGNQSKPVRSKWLQRVPRHTHPQTRIPHRARNQPSRVTALTPRPPVSASGSFATRRLAHMKLLANSGNSVVSGGRRPTQKRKSWSCWFWSSFLSCQRRSRPGGSSIQKTARKLWLWLRMYRELLDN

Amino Acids from 3' Exons

TSFKVEPFFSAVSLYTCLTLSCPTDYRKTFLAGEHGFPVMWERWTLISRVEVATRVSQFVEANDGCSEEYRGTPILKQGSHTGPEISPPGQPLRGLPSALQAVLLPGGNWPTSFQTLGTLLSVAEAEDPLKRGNPGAAGFGAVSDYLARGDPDLGEGAASRKRRGSCGSGGCTESSWTT,HPSKLSPFFPLVSTHVHSHVPRITERHSLQENMASQCGKDGLSPGKWQPEASSLKQMMAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSEASRQRFRQFCYQEVTGPHEAFSKLWELCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPGQQ,ILQSALFFRCESLHMSDTLMSHGLQKDIPCRRTWLPSDVGKMDSDLQGRSGNQSKPVRSKWLQRVPRHTHPQTRIPHRARNQPSRVTALTPRPPVSASGSFATRRLAHMKLLANSGNSVVSGGRRPTQKRKSWSCWFWSSFLSCQRRSRPGGSSIQKTARKLWLWLRMYRELLDN