McDonnell Genome Institute

Washington University

CircRNA

chr16|31271846|31278109|+|ITGAM|ENST00000287497.12

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9332

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

GTQFSLMQYSEEFR

Amino Acids from 5' Exons

FSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKV,SLCSTLKNSGFTLPSKSSRTTLTQDHWSQRSCLGGHTRPRASAKW,LFDAVLRIPDSLYLQRVPEQPPKITGEANNAAAWADTHGHGHPQSG

Amino Acids from 3' Exons

VMLPPSSYGTGCKAWFWGHLDISTSAWRCSGRTLACGSPTLMSRAP,LCCRHHLTEPGAKPGSGGTSISAHRPGSDVQAEHWHVGVQRCQGHP,YAAAIILRNRVQSLVLGAPRYQHIGLVAMFRQNTGMWESNANVKGTQ