McDonnell Genome Institute

Washington University

CircRNA

chr16|30700615|30704315|+|SRCAP|ENST00000262518.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9154

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

LVDLSGGWDALVGPGPWK

Amino Acids from 5' Exons

VLQRLVDLSGGWDALVGPGPWKAGPGGRWPRMRPAPSMPCSRTPAPRPAVLVITTQSFFRHPRGSLGVGPCRAAPPLLTLSSQSYRH,CSRGWWTAEAGTPWWAPGPGRRVPVAGGPEGQLPACPAAGRQPLGQQYWQPSHSSGIQGGAWEWDHAEQPLPCSPSAPSPTDT,APEAGGPERRLGRPGGPRALEGGSRWPVAQNEASSQHALQPDASPSASSTGDNNPVILQASKGEPGSGTMQSSPSPAHPQLPVLQTQ

Amino Acids from 3' Exons

MVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAADLANKGPKWEKSHAEIAEQAKH,WCRTAQAAILCPLPHPVPQPLVGQAASPRSTLKIPHWMDLQAPQMVPQCPWRGSAYPRLLTWLTRARSGRRAMPKLQNRPS,GVGRHDRQQSCVPCLIQFPSLWGRRHLPAAHSSRFLTGWTSRPPRWCHSAPGGVQLIPGCPGQGPEVGEEPCRNCRTGQA