McDonnell Genome Institute

Washington University

CircRNA

chr16|30069498|30070029|+|ALDOA|ENST00000338110.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9703

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

11

Peptide

AAQEEYVKRALVLAAVYK

Amino Acids from 5' Exons

VLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVT,CWLLSTRLVTTTSTWKAPCSPTWSPQAMLALRSFLMRRLPWRPSQRCAAQCPPLSL,AGCCLQGSEPPHLPGRHLAEAQHGHPRPCLHSEVFSGDCHGDRHSAAPHSAPRCH

Amino Acids from 3' Exons

GSPSCLEARVRRRRPSTSMPLTSAPCSPGPPSPTAEPCRPLPRPGAGRRRTRLRRRSMSSEP,DHLPVWRPEGGGVHQPQCHQVPPAEALGPDLLLRPSPAGLCPEGLGREEGEPEGCAGGVCQASP,ITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRAL