McDonnell Genome Institute

Washington University

CircRNA

chr16|30067233|30068978|+|ALDOA|ENST00000338110.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9811

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

7

Peptide

YASICQQELATTSTMPYQYPALTPEQK

Amino Acids from 5' Exons

ELATTSTMPYQYPALTPEQKKELSDIAHRIVAPGKGILAADEST,NLLLPAPCPTNIQHPRSRRRSCLTSLTASWHLARASWLQMSPL,TCYYQHHALPISSTDPGAEEGAVHRSPHRGTWQGHPGCRVH

Amino Acids from 3' Exons

GWMGCLSAVPSTRRTELTSPSGVVCRLGNTPPQPSPSWKMPMFWPVMPVSAS,VGWAVALCPVQEGRSLRQVALCAEDWGTHPLSPRHHGKCQCSGPLCQYLPA,LDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ