McDonnell Genome Institute

Washington University

CircRNA

chr16|28897999|28898451|+|ATP2A1|ENST00000357084.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9112

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

FLEYEVIR

Amino Acids from 5' Exons

VIRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVK,SASRRNSPWSSPETESPCLSIAPQPNLPGLLWATRCLS,DPPANEEGIHPGVLPRQKVHVCLLLPSQIFPGCCGQQDVCQ

Amino Acids from 3' Exons

GAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYE,VPLRASSTAVTMCELAPPGCHRGRRKRSWRSRSGALAGTPCAAWPWPPGTPPRSERKWSWMTLPGSWSM,CPGRHRPLLCASWHHPGATDGAGEGKDHGGDQGVGHWPGHPALLGPGHPGHPPEARGNGPGLCQVPGV