McDonnell Genome Institute

Washington University

CircRNA

chr16|28843949|28844551|-|TUFM|ENST00000313511.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9627

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

VEAQGRDPELGLK

Amino Acids from 5' Exons

ALRCSTRAWRGPRPEITSGPWSEASGRTCGGAWSWSSQVPSSPTRRWRP,HDVPQEPGEGRGRRPRGPGPRLEAGGLAAGPGHGQARFHQAPPEGGGP,IEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQ

Amino Acids from 3' Exons

GRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVP,VGTLSASLCRSYWMLWTLTSQCPPGTWRSLSCCLWRRCTPSL,SGPVRPEVCAEATGCCGHLHPSARPGPGEAFPAACGGGVLRP