McDonnell Genome Institute

Washington University

CircRNA

chr16|28834505|28835758|+|ATXN2L|ENST00000563314.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9989

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

LHQHGPCYPGSLPPQR

Amino Acids from 5' Exons

APFLRSARTNTSQPQPRRCRPPRLLARLWWLPRPILPTSPTTLSSSQASQPCSPWPTTPH,LPSSAALGPTPASLSPADDAGRRGCWPASGGCHALFFLHPLQPSAVPRPASHDAAHGPLPLT,SLPPQRSDQHQPASAPPMMQAAAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQ

Amino Acids from 3' Exons

PLFTSPTHTMPHSSMPTSRSRLPRLLEASRSPSMRPPVLSRCLPWGVLSGPGAGMGGQKKGSGSFLSGEDWGPASCWPVWHSTFPSPAASGGAGPTLGQWTATAESVPPRGPDRHAALSATGTFCPVPSEQLPPASRCVCHPPPAAAPRLHQHGPCYP,HCSPVLPTPCHTAPCPPAAAGYHAYWKPAAVPACGPQSCPGACHGGCVVLVQEWVARRRDRARGHFVARTGGQRVAGLCGTQPSPPQQHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNMAHVTQ,TVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQVPAMGGAEWSWCRNGWPEEGIELGVISEWRGLGASELLACVALNLPLPSSIRRGRPHTWAVDSHSRICTTQGPQARRPLCHRDLLPSPLRAASPSQPLCMPSTTSSCPTASPTWPMLP