McDonnell Genome Institute

Washington University

CircRNA

chr16|28125688|28146203|-|XPO6|ENST00000304658.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9859

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

VTSLVWISGR

Amino Acids from 5' Exons

DTGTSRRRTTAGGCTAPETAPCCRPWAAWPSTLSGMCLLHGSMMPSQSWK,TQVEHHGGERLPAAALLPERLELPAAGRGPPGRVLYRGCVCCTVQCPHSRGK,HRLNITAENDCRRLHCSLRDLSSLLQAVGRLAEYFIGDVFAARFNDALTVVE

Amino Acids from 3' Exons

PTHEGYFSCLDIWTLFLDYLTSKIKSRLGDKEAVLN,LLMKVTSLVWISGRCFWTIQVKLKVVLETRKQFST,YSRLLLLFGYLDAVFGLSDKNKSSWRQGSSSQQ