McDonnell Genome Institute

Washington University

CircRNA

chr16|28111816|28113050|-|XPO6|ENST00000304658.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9501

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

QAAAICVPLTGLTGHHR

Amino Acids from 5' Exons

AQVLVCRALSNILLLPWPNLPENEQQWPVRSINHASLISALSRDYRNLKPSAVAPQRKMPLDD,PRCWCAEPSLTSCCFRGQTFQRMSSSGPCAPSTTPASSLHSPGTIATSPVLLPHRERCHWMT,PGVGVPSPLHLAASVAKPSREAAVARALHQPRQPHLCTLPGLSQPEAQCCCPTEKDATG

Amino Acids from 3' Exons

VQDKLLLSACHLLVSLATTVRPVFLISIPAVQKVFNRITDASALRLVDK,SKTSCCYLRATYWSHWPPPCGPSFSASLQCRKYSTESLMPLPCDLSI,PRQAAAICVPLTGLTGHHRAARLSDQHPCSAESIQQNHCLCPATCR