McDonnell Genome Institute

Washington University

CircRNA

chr16|27681398|27708920|+|KIAA0556|ENST00000261588.8

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9324

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

GICLQSGR

Amino Acids from 5' Exons

VIKGKGICLQSGRTMLRFSFPPNLSQTLPKLLLYSQTRRGCAP,SKGKEFVCKAEGQCGFRSHQTAKPDSPSSCCIPRPGEDVL,HKRERNLSAKRKDNAEVFVPTKPEPNLTPQAPAVFPDQERMCS

Amino Acids from 3' Exons

DKQRMRADEIKDAIYVTMEILSNWGNSWWVGLTEVEFFDLNDTKLYVSPHDVDIRNTATPGELGRLVNRNLA,TNREGQTRSKMPSTPWRSCPTGATRGGWVSQKSSSLTMTQSFMCRPTMWISGTQPRLGSWAASSTGT,QTENEGRRDQRCHLRDHGDPVQLGQLVVGGSHRSRVLLEHKALCVAPRCGYPEHSHAWGAGPPRQQELS