McDonnell Genome Institute

Washington University

CircRNA

chr16|27677728|27681530|+|KIAA0556|ENST00000261588.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9626

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

LLYSQTR

Amino Acids from 5' Exons

ELRRSLELSVNLQRKQKDCSSDEYDSIEEDILSEPEPEDPALVGHPRHDRPPSSGDWTQKDVHGEQETEGRSSPGPDTLVVLEFNPASK,SEEAWNLVIYKGNKRIVPAMSMTLLRKTYSLSLSQRTRHWWAIPDMTALLPVATGLRKMFTGNRRQKDALLQAQTPSWCWNLTQLPK,AEKKPGTCKSTKETKGLFQRVLYGRHTLAARGPGTGGPSQTPPSFQWRLDSERCSRGTGDRRTLFSRPRHPRGAGIPSFQ

Amino Acids from 3' Exons

VIKGKGICLQSGRTMLRFSFPPNLSQTLPKLLLYSQTRRGCAP,SKGKEFVCKAEGQCGFRSHQTAKPDSPSSCCIPRPGEDVL,HKRERNLSAKRKDNAEVFVPTKPEPNLTPQAPAVFPDQERMCS