McDonnell Genome Institute

Washington University

CircRNA

chr16|27654607|27677996|+|KIAA0556|ENST00000567894.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9894

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

YQISHQYQALWF

Amino Acids from 5' Exons

DTKSPTSTKPCGFNFSLLNACGHSDPSSSVDKERILLTIQDVM,IPNLPPVPSPVVLTSPFMHVDILTLQAAWTKKGSSLFRM,YQISHQYQALWFLLPSECMWTFPFKQRGQRKDPLNYSGCD

Amino Acids from 3' Exons

ELRRSLELSVNLQRKQKDCSSDEYDSIEEDILSEPEPEDPALVGHPRHDRPPSSGDWTQKDVHGEQETEGRSSPGPDTLVVLEFNPASK,SEEAWNLVIYKGNKRIVPAMSMTLLRKTYSLSLSQRTRHWWAIPDMTALLPVATGLRKMFTGNRRQKDALLQAQTPSWCWNLTQLPK,AEKKPGTCKSTKETKGLFQRVLYGRHTLAARGPGTGGPSQTPPSFQWRLDSERCSRGTGDRRTLFSRPRHPRGAGIPSFQ