McDonnell Genome Institute

Washington University

CircRNA

chr16|2581294|2583585|+|PDPK1|ENST00000268673.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9897

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

TPTIPSW

Amino Acids from 5' Exons

FRPLGSWMHNIPACGRTPTIPSW,SDLWALGCIIYQLVAGLPPFRA,QTFGLLDAYTSLWQDSHHSEL

Amino Acids from 3' Exons

VLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGN,FMPQSGAVRKWKDTDLLKHTRSSSPSRGRTCTSRRLRSSPLTCRLCRKTTRTAMA,FRCHKAVRLGNGRIRTSSTPVLRVRHVGEPAPADASEAHRLPAGYVGRRRGLLWQ