top of page

McDonnell Genome Institute

Washington University

CircRNA

chr16|2520768|2528718|+|AMDHD2|ENST00000302956.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

SQPACQVAHDPPR

Amino Acids from 5' Exons

GGSVGARRPHLGPREAVLGAARGRRAAGLRGPHLGSRIHRRADQ,EDLWVRGGRILDPEKLFFEERRVADERRDCGGRILAPGFIDVQIN,RICGCAEAASWTQRSCSLRSGAWPTSGGTAGAASWLPDSSTCRST

Amino Acids from 3' Exons

GWCWSPMPSLPWAWATAGTRWDSRKWKWTVRPTWQVSALTHWVPGPSPHARWPTTPPEPALSALKAPRRVAAPQWTSVSGTSCRPQ,AGAGHRCHPCLGPGQRPAHAGTAGSGSGRSDGLRGRAPPTGSQVPARMPGGPRPPQSLPSLLSRHQDAEWQHSPNGRLCPALPAGH,LVLVTDAIPALGLGNGRHTLGQQEVEVDGLTAYVAGERPDPLGPRSQPACQVAHDPPRACPLCSQGTKTLSGSIAPMDVCVRHFLQAT

bottom of page