McDonnell Genome Institute

Washington University

CircRNA

chr16|24930783|24952370|-|ARHGAP17|ENST00000289968.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.961

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

IVTGALK

Amino Acids from 5' Exons

LLKNPLQHPRNRATHLLATPGARVLQEHLSIHPVCHQSHPPEAPLLPPSTRASLQASPPPPPSSQHPGGTPAACLQSKLPITHRRSPLRRPRHCTPNPIARALPTPWHCPVSMDLSSHLTPLPRLQRPPVLRPENRTPVCQLLRPWQGVTLKLHSHMLEPYRDRDQYQSQGTGPACPHPPNLLVSTQLGTAASPTQHQQLPRQ,CKTRSSTPETGQPTSWPPRGPEFFRNISASTQSVTKATHPKPLSSHPAHGPASRPALRPLPALSTPEVLQQLVSNPSSQSPTAAAPYAGHATDAHQTQPGPSQPHGIAQAWTAAISHPSPDSNAPQYSAPRKTEPQSASSSDPGRGPNCTATCWNLTETETSTKAKEPAQRAPTPPTSWCPLSWGQQPHQHSTNSFQDSN,VKKPAPAPPKPGNPPPGHPGGQSSSGTSQHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPTQATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLAGGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVT

Amino Acids from 3' Exons

VLNPIYGNCLNLLLICMKNGHKLQ,CFKILFTGIATFDDFSVRMDTSCK,ALKSYLRELPEPLMTFNLYEEWTQVA