McDonnell Genome Institute

Washington University

CircRNA

chr16|24930783|24943862|-|ARHGAP17|ENST00000289968.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9694

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

IVTEHLLK

Amino Acids from 5' Exons

LLKNPLQHPRNRATHLLATPGARVLQEHLSIHPVCHQSHPPEAPLLPPSTRASLQASPPPPPSSQHPGGTPAACLQSKLPITHRRSPLRRPRHCTPNPIARALPTPWHCPVSMDLSSHLTPLPRLQRPPVLRPENRTPVCQLLRPWQGVTLKLHSHMLEPYRDRDQYQSQGTGPACPHPPNLLVSTQLGTAASPTQHQQLPRQ,CKTRSSTPETGQPTSWPPRGPEFFRNISASTQSVTKATHPKPLSSHPAHGPASRPALRPLPALSTPEVLQQLVSNPSSQSPTAAAPYAGHATDAHQTQPGPSQPHGIAQAWTAAISHPSPDSNAPQYSAPRKTEPQSASSSDPGRGPNCTATCWNLTETETSTKAKEPAQRAPTPPTSWCPLSWGQQPHQHSTNSFQDSN,VKKPAPAPPKPGNPPPGHPGGQSSSGTSQHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPTQATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLAGGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVT

Amino Acids from 3' Exons

NTCNGSSHIRPCGCSDTHHSACRLVLP,TLAEMAAATSVHVVAVIEPIIQHADWFFPE,HLLKWQQPHPSMWLQLNPSFSMPTGSSLK