McDonnell Genome Institute

Washington University

CircRNA

chr16|24789231|24816956|+|TNRC6A|ENST00000315183.11

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

48

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LGGTIPR

Amino Acids from 5' Exons

ITTVLQDPIMKIPSGDLCLLQVILAQTVRMLLVTCRKKKHGPQPLAVIRSWLQNVWMLILPPVLNQRETSLSWLQGTQVVKKMAFGIALDLVPKTSLLVAAAIMWAMEVVLGHGVFPMEPAHVRSLWMLLKANLKVATIEMLGALVLHQMEGIQALIQLATMVPGQYRTMDLPKGLGVVVLALIFSAVLARCLTIRVLTLKVVVLPMVPGEAFRKLVNLKVVHRRFHSVVNLKILPLKLDQITLLTLPLVYQTPVQCRIMSCLVVTQGPGVAQIILRCRLHQVMALPFLTLAMESQKVEALMVLHGVPMVLITLETNVQALMAKLMVTLMQLCSLAMVLWALTFKLTQTKEVVCGNLVQQTPRVHHGEVEMAQILEEVEEDGEPLHKTLALIYPALSGTNCLAISIPMIVQMAMVRRLQMDGNLLRKRIRVLPHLRQMSKAVCGPKQEVQWRAMVVQKALDALRKKELGKVRVETEEKLISTHYSKALTELTIHVSCPTLVGDRLLLSRILPGIQKHHLEGNERLTMGQRPGEALQHRLLTQGHVIRLALMVMIPHLYQGGAIPNLLGGEIPKAQTARGGGKMILLLQEWSRAISGGIAKRRRLHGMTRKRINRDGVMDKNQAKGGLFLPVITGEKLQGITIGVRPIRNPAQEVVTVTGPFPVGTNLVKLVLSLGETTIQIIHQDGMNLLNLLLPRDGETLQSLISLVGEIRQSQSALQTGTSNKTLLDLGESHQLQANLLVQAGWGDLYQPQQKKKNPQAGRNHPQNLYVAKWRLMMELQLGEIQANTTTKMTCGTKTSQMATAVQTSKHRYISCRLQVPSQTKRQAVAL,YKPQYFRIPLKFPAGTCVFYKFHKLECCCKLVGKRSMALSPWQSGVGFRMYGCFCLQFIREKHHYHGFREHRWKRWPSEHWTWFPKQVCSWQQQCGPWKYWAMGFFPWSHNKHMSGLCGCSKQIKQQNECLGHCKFFIKWRVKSKHFEFSQPWCLASIREQWTCPKRACREWFWHYSVQYYRPDAQSEYLSEWWFYPWYLGKPSGNLISKWYTEGFIQWSTSKYYHNDWTKHYLYDLFTKLRFSAEAAHRGLACEHNESSSDAGSIRYEWHFPFSPQWRVKKWRLLWYYMGCLWFLLWRQMFRPWPSWHCECNSNAAWRKWSYGHLSSHKQRRWCVGIWCSKLPEYIMGKWKWRKFWRKSKRMGNPCTKHWHFTQRVEQTAQSAFQCKWQWDVYKWMEIYGRGSGFCHISDKAKQCVGQNRRYSGERWYRKHWTPGKRNWGKSERQKKNSAHITPKHCKQNLRSTCPVQLWLGTDSYAEYCLGYRNITRGTKDQWDRGLGKLCNTDFLRGMYRDPWYLICIRVGRSQTCSEVGRFQRLKLPGGVGRFCCYRNGQEQSVGELQRGEGCMELAKETGMGWTKIKPRVVCFCQLGRNFKEPLGGQEIQLRRQQVRFRLERTWNFFHLGKQHKSKFIRMGIFTYSFPGMGRPSKVSVSRLGRFVKASQLSRLEQATRHCWILGNPTSYRQTSWYRLAGGTYTSPSKRRRTHRLGGTIPRIYTSQNGDWNFSLGRSKQIQLQKCEHVEQKRPKWQQPFRPASTGTSAANACKCHLKQRGKQWL,INHSTSGSHYENSQRGPVSSTSDSSTNCKNAVVSDLSEKEAWPSAPGSDPELASECMDADSASSSESERNITIMASGNTGGEKDGLRNSTGLGSQNKFVVGSSSNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSSSSNGGLNPSTLNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTIGQMPNNQSINSKVSGGSTHGTWGSLQETCESEVSGTQKVSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNHPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQPGVNGPMGTNFQVNTNKGGGVWESGAANSQSTSWGSGNGANSGGSRRGWGTPAQNTGTNLPSVEWNKLPSNQHSNDSANGNGKTFTNGWKSTEEEDQGSATSQTNEQSSVWAKTGGTVESDGSTESTGRLEEKGTGESQSRDRRKIDQHTLLQSIVNRTDLDPRVLSNSGWGQTPIKQNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACIDKTSPNGNDTSSVSGWGDPKPALRWGDSKGSNCQGGWEDDSAATGMVKSNQWGNCKEEKAAWNDSQKNKQGWGDGQKSSQGWSVSASDNWGETSRNNHWGEANKKSSSGGSDSDRSVSGWNELGKTSSFTWGNNINPNNSSGWDESSKPTPSQGWGDPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAISNKEASSGS,ITTVLQDPIMKIPSGDLCLLQVILAQTVRMLLVTCRKKKHGPQPLAVIRSWLQNVWMLILPPVLNQRETSLSWLQGTQVVKKMAFGIALDLVPKTSLLVAAAIMWAMEVVLGHGVFPMEPAHVRSLWMLLKANLKVATIEMLGALVLHQMEGIQALIQLATMVPGQYRTMDLPKGLGVVVLALIFSAVLARCLTIRVLTLKVVVLPMVPGEAFRKLVNLKVVHRRFHSVVNLKILPLKLDQITLLTLPLVYQTPVQCRIMSCLVVTQGPGVAQIILRCRLHQVMALPFLTLAMESQKVEALMVLHGVPMVLITLETNVQALMAKLMVTLMQLCSLAMVLWALTFKLTQTKEVVCGNLVQQTPRVHHGEVEMAQILEEVEEDGEPLHKTLALIYPALSGTNCLAISIPMIVQMAMVRRLQMDGNLLRKRIRVLPHLRQMSKAVCGPKQEVQWRAMVVQKALDALRKKELGKVRVETEEKLISTHYSKALTELTIHVSCPTLVGDRLLLSRILPGIQKHHLEGNERLTMGQRPGEALQHRLLTQGHVIRLALMVMIPHLYQGGAIPNLLGGEIPKAQTARGGGKMILLLQEWSRAISGGIAKRRRLHGMTRKRINRDGVMDKNQAKGGLFLPVITGEKLQGITIGVRPIRNPAQEVVTVTGPFPVGTNLVKLVLSLGETTIQIIHQDGMNLLNLLLPRDGETLQSLISLVGEIRQSQSALQTGTSNKTLLDLGESHQLQANLLVQAGWGDLYQPQQKKKNPQAGRNHPQNLYVAKWRLMMELQLGEIQANTTTKMTCGTKTSQMATAVQTSKHRYISCRLQVPSQTKRQAVAL,YKPQYFRIPLKFPAGTCVFYKFHKLECCCKLVGKRSMALSPWQSGVGFRMYGCFCLQFIREKHHYHGFREHRWKRWPSEHWTWFPKQVCSWQQQCGPWKYWAMGFFPWSHNKHMSGLCGCSKQIKQQNECLGHCKFFIKWRVKSKHFEFSQPWCLASIREQWTCPKRACREWFWHYSVQYYRPDAQSEYLSEWWFYPWYLGKPSGNLISKWYTEGFIQWSTSKYYHNDWTKHYLYDLFTKLRFSAEAAHRGLACEHNESSSDAGSIRYEWHFPFSPQWRVKKWRLLWYYMGCLWFLLWRQMFRPWPSWHCECNSNAAWRKWSYGHLSSHKQRRWCVGIWCSKLPEYIMGKWKWRKFWRKSKRMGNPCTKHWHFTQRVEQTAQSAFQCKWQWDVYKWMEIYGRGSGFCHISDKAKQCVGQNRRYSGERWYRKHWTPGKRNWGKSERQKKNSAHITPKHCKQNLRSTCPVQLWLGTDSYAEYCLGYRNITRGTKDQWDRGLGKLCNTDFLRGMYRDPWYLICIRVGRSQTCSEVGRFQRLKLPGGVGRFCCYRNGQEQSVGELQRGEGCMELAKETGMGWTKIKPRVVCFCQLGRNFKEPLGGQEIQLRRQQVRFRLERTWNFFHLGKQHKSKFIRMGIFTYSFPGMGRPSKVSVSRLGRFVKASQLSRLEQATRHCWILGNPTSYRQTSWYRLAGGTYTSPSKRRRTHRLGGTIPRIYTSQNGDWNFSLGRSKQIQLQKCEHVEQKRPKWQQPFRPASTGTSAANACKCHLKQRGKQWL,INHSTSGSHYENSQRGPVSSTSDSSTNCKNAVVSDLSEKEAWPSAPGSDPELASECMDADSASSSESERNITIMASGNTGGEKDGLRNSTGLGSQNKFVVGSSSNNVGHGSSTGPWGFSHGAIISTCQVSVDAPESKSESSNNRMNAWGTVSSSSNGGLNPSTLNSASNHGAWPVLENNGLALKGPVGSGSSGINIQCSTIGQMPNNQSINSKVSGGSTHGTWGSLQETCESEVSGTQKVSFSGQPQNITTEMTGPNNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNHPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQPGVNGPMGTNFQVNTNKGGGVWESGAANSQSTSWGSGNGANSGGSRRGWGTPAQNTGTNLPSVEWNKLPSNQHSNDSANGNGKTFTNGWKSTEEEDQGSATSQTNEQSSVWAKTGGTVESDGSTESTGRLEEKGTGESQSRDRRKIDQHTLLQSIVNRTDLDPRVLSNSGWGQTPIKQNTAWDTETSPRGERKTDNGTEAWGSSATQTFNSGACIDKTSPNGNDTSSVSGWGDPKPALRWGDSKGSNCQGGWEDDSAATGMVKSNQWGNCKEEKAAWNDSQKNKQGWGDGQKSSQGWSVSASDNWGETSRNNHWGEANKKSSSGGSDSDRSVSGWNELGKTSSFTWGNNINPNNSSGWDESSKPTPSQGWGDPPKSNQSLGWGDSSKPVSSPDWNKQQDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAISNKEASSGS

Amino Acids from 3' Exons

NFVLVSHGKVIQTLTLKLTLTSLLAVSTIFQLILCGKLTTSGTGTV,ISSWAMERLSKHPNPLRHSWQCHKQSFNYCAGSPPQGQEQ,FRPGEPWKGYPNIDPETDPYVTPGSVINNLSINTVREVDHLRDRNS,NFVLVSHGKVIQTLTLKLTLTSLLAVSTIFQLILCGKLTTSGTGTV,ISSWAMERLSKHPNPLRHSWQCHKQSFNYCAGSPPQGQEQ,FRPGEPWKGYPNIDPETDPYVTPGSVINNLSINTVREVDHLRDRNS