McDonnell Genome Institute

Washington University

CircRNA

chr16|24567142|24570499|+|RBBP6|ENST00000319715.8

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9023

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

MGEVLTLETHLK

Amino Acids from 5' Exons

KYKPWATPQRKITEDSRPVTTSNSSLCTCSTTSFVSASSPYTSSPSGCSSSTVFSSVSSWPATTRWVCPSSRVSSSSCQFINTLGIIRSADSSFKYHPNNTSTTFVQGRILRAATTKRR,SINRGRHHSERSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSVPPPGFPPAPANLSTPWVSSGVQTAHSNTIPTTQAPPLSREEFYREQRRLKE,VTVGDTTAKDHRGLKARHYQQLQSLYLFHHLLCIRLLPIHFLSLRVFLLHSFLLSFLLASHHPLGIVSLLQGFLQLLPIYQHLGYHQECRQLIQIPSQQHKHHLCPGKNSIESSDDKK

Amino Acids from 3' Exons

VISLWFFVFKKFIYLFIKIWFNTFTLLFSIIQPLTFSFLFTVTSIPQKRQRQEPQLPFTVISWISSIVKVTPLQTLSFTIKISSSVGTVSTCTSRGNRTIFIQRSSTTIHESILWEKCLRPIKRTLPRMGEKIRVVKILRLCCWSTATLSKRELFSREIFATHQEFSLHKRPQRRLCWWAKSKSKHRQLSRKAFSKRWSQSEGYKVKREGEKRSRRWRKAETQKKKKRGGKGFSEPRVIRDFEIKRTYRCRKNRLIVCSPKRCHTCRTNGCRINHFISVKRQERKGTKSKGNQTEEWICCVQKRKYCKTCRTPRKSRWRTEISSITSNKSQRGDSEDQYIIIFLSEGKNHWNPQKSSLISKRTPRNKTSQRGKSEEGLFQRCQIRKANNGRKGQEAEKQTTGRKKKKKNRKRRRRFVFFNENLETRSDNSETITKAQNGTYKNGDPKGQNFFKCASQKNQTQQRNWEENWKYRKYIKHKRTLKIGVNIQSTRKSQRKGQTKSDWNRIQLNSGGLHQ,SKSPYSGSSYSRSSYTYSKSRSGSTRSRSYSRSFSRSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQSPNKRNVPQGETEREYFNRYREVPPPYDMKAYYGRSVDFRDPFEKERYREWERKYREWYEKYYKGYAAGAQPRPSANRENFSPERFLPLNIRNSPFTRGRREDYVGGQSHRSRNIGSNYPEKLSARDGHNQKDNTKSKEKESENAPGDGKGNKHKKHRKRRKGEESEGFLNPELLETSRKSREPTGVEENKTDSLFVLPSRDDATPVRDEPMDAESITFKSVSEKDKRERDKPKAKGDKTKRKNDGSAVSKKENIVKPAKGPQEKVDGERERSPRSEPPIKKAKEETPKTDNTKSSSSSQKDEKITGTPRKAHSKSAKEHQETKPVKEEKVKKDYSKDVKSEKLTTKEEKAKKPNEKNKPLDNKGEKRKRKTEEKGVDKDFESSSMKISKLEVTEIVKPSPKRKMEPDTEKMDRTPEKDKISLSAPAKKIKLNRETGKKIGSTENISNTKEPSEKLESTSSKVKQEKVKGKVRRKVTGTEGSSSTLVDYT,LNLPIVVLRIQEVHILILNQDLVQHVHALILDHSAAHILVPIHGHLHTPEEAEARAAITVHGLDLMDIIDLGQGHPLTDAIIHDQDLLKRLGDSLLINVMYLKGKQNVNILIDTEKFHHHMTKHIMGEVLTLETHLKKNATENGRENIESGMKNIIKVMLLEHSLDPQQIERTFLQRDFCHLTSGILPSQEAAEKTMLVGKVIEVETVATIQKSFQQEMVTIRRIIQSQKRRRVKTLQEMVKEISIRNTEKEEKGRKVRVFTQSYRLLGNQENLQVLKKIKQTHCLFSQVEMMPHLLEMNQWMQNQSLLNQCLKKTREKGINQKQRVIKPNGRMMDLLCPKKKILNLLKDPKKKMENVRDLLDLNLQLKKPKRRLRRLTILNHHLPLRRMKKSLEPPEKLTLNQQKNTKKQNQSKRKKRRTIPKMSNQKSQLRKKRPRSLMRKTNHLIIREKKEKEKLKKKAIKILSLLQKSRNKLKNHHQSAKWNLILKKWIGPLKRTKFLVRQPKKSNSTEKLGRKLEVQKIYQTQKNPLKNWSQHLAKLNKKKSKERSDEKLELKDPAQLWWITP