McDonnell Genome Institute

Washington University

CircRNA

chr16|24559504|24567505|+|RBBP6|ENST00000319715.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9914

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

EEEAYAIGK

Amino Acids from 5' Exons

RSICNWEERETSLLTRGAIFFLRRRSYPRIVVSHLQGYYDCCCDSLLWKQLL,EAYAIGKKEKPPFLPEEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDE,KHMQLGRKRNLPSYQRSHLLPQKKMILSQMNCCVSSARILLMLLFPAVETVTVMN

Amino Acids from 3' Exons

KYKPWATPQRKITEDSRPVTTSNSSLCTCSTTSFVSASSPYTSSPSGCSSSTVFSSVSSWPATTRWVCPSSRVSSSSCQFINTLGIIRSADSSFKYHPNNTSTTFVQGRILRAATTKRR,SINRGRHHSERSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSVPPPGFPPAPANLSTPWVSSGVQTAHSNTIPTTQAPPLSREEFYREQRRLKE,VTVGDTTAKDHRGLKARHYQQLQSLYLFHHLLCIRLLPIHFLSLRVFLLHSFLLSFLLASHHPLGIVSLLQGFLQLLPIYQHLGYHQECRQLIQIPSQQHKHHLCPGKNSIESSDDKK