McDonnell Genome Institute

Washington University

CircRNA

chr16|23700538|23701114|-|ERN2|ENST00000562562.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9448

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

MLQQQPQVVEK

Amino Acids from 5' Exons

LLSLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQVGPPPPQVYLGRTLLLLSETTQQLSPSTQLFCPLPPSQQLPRPLRSCSVSSCSLVRPSQSQILGPSRGRAWPGQSSLRLSCYSNSRRWWRSSRRPPWHLQTLLTSPRMPSPCTRGPAGGARRGFRVPQSKPSHSTTLK,YAAERNFGTPSCIQKKKLQTLTWGWDPKTCWQLASLLSSWEGGFSLGRAHRPDLRSIWGERCFSSLRPLSNSLPLPSSDFAPCLPPSSSPGPCDLALVHAVWGHLSHRYWAHHGAGRGQDKALLGSHVTATAAGGGEAAGDPPGTCRLCSHLPGCPVPALGGQPEEPEEASESLKASPATRRP,IEPEPRETLGLRAASRRKNSRLLLGAGTPRPAGSPHCCPPGRVDSLCDEAGRPTALTSGLSGENAASPLDHSATLSLYPALILPPASLPAAPQAPAILLCKFMQSGEAISVTDTGPITGQGVARTKLSALMLQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPE

Amino Acids from 3' Exons

LLSLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQVGPPPPQVYLGRTLLLLSETTQQLSPSTQLFCPLPPSQQLPRPLRSCSVSSCSLVRPSQSQILGPSRGRAWPGQSSLRLSCYSNSRRWWRSSRRPPWHLQTLLTSPRMPSPCTRGPAGGARRGFRVPQSKPSHSTTLK,YAAERNFGTPSCIQKKKLQTLTWGWDPKTCWQLASLLSSWEGGFSLGRAHRPDLRSIWGERCFSSLRPLSNSLPLPSSDFAPCLPPSSSPGPCDLALVHAVWGHLSHRYWAHHGAGRGQDKALLGSHVTATAAGGGEAAGDPPGTCRLCSHLPGCPVPALGGQPEEPEEASESLKASPATRRP,IEPEPRETLGLRAASRRKNSRLLLGAGTPRPAGSPHCCPPGRVDSLCDEAGRPTALTSGLSGENAASPLDHSATLSLYPALILPPASLPAAPQAPAILLCKFMQSGEAISVTDTGPITGQGVARTKLSALMLQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPE