McDonnell Genome Institute

Washington University

CircRNA

chr16|208077|220747|-|LUC7L|ENST00000293872.12

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LAETQEEISAEVSAKR

Amino Acids from 5' Exons

AMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAK,QWITWSPLLLNVIGELSSPRSGWQKHRRKSVRKFLQ,NGSLGVLYCMSENARQEAAGRNTGGNQCGSFCK

Amino Acids from 3' Exons

RMDLGECTKIHDLALRADYEIASKERDLFFELD,AWIENVPKSTTWPSEQIMRLQVKKETCFLN,HGFRRMYQNPRLGPPSRLDCKRKRPVFIR