McDonnell Genome Institute

Washington University

CircRNA

chr16|20661793|20671671|-|ACSM1|ENST00000307493.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

MILQQDFTR

Amino Acids from 5' Exons

TLLKYPINHFWGVSSIYRMILQQDFT,HCNTPLTTFGGYHLYIEFCSRISP,IVEIPHPLLGGIIYISNDSAAGFHQ

Amino Acids from 3' Exons

ISIPRTHLCVKDLGPNGHLLHQWDHRLPQDGKTLPWVGLTTLLPRK,SASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPG,QHPQNTPVLSQRPWTQWSSSSPVGPQASPRWQNTPMGWPYNPPSQE