McDonnell Genome Institute

Washington University

CircRNA

chr16|19173429|19184147|+|SYT17|ENST00000355377.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9486

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

ALIPSSQGFLSR

Amino Acids from 5' Exons

GFLSRISGLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPW,VFFLESLVCCCADGPAGTAVRSATSPAVASQVRMKLKFWDLSLLRPLPG,FSFNLWSAAVQMDLPALLSEVLRVQLLPVKGSNSGTFPCSDPSLA

Amino Acids from 3' Exons

VLSQDVPALHSSILNPSSLAFSAPRRSPSNLRCSDGPITPTTISGSSNPTCTPSTPTATMWTLQTRRSCPSTSWACCTSALSTTCCTTTSPCASRPGTCHLPSPTMARARTWRTPTPTSRSVSCQTRRTQSRPGSNARPRSPCLRSATPSRSPSWRPRGGPCSPWWILISSPATVSLGKFLCLCVKLTWSRAGTGGRRFPVL,SVKTSQLSTHRYTHRVWRSQRQEGAHPTFGAQTDLPRRLFQEVRTPPVLPRLQQRRCGLSDRRGDPVQVPAGHAALQHSVRPAAQPPHRARDRGQGPATSHLPRWLAPGHGALQPLRQDLSPARPEELKADRGQTQDPEARVGALHLRDPLPGGPEEDPAPDRGGFVLPPLCHWESFCAFVSPGQGRALVEGADSQFS,LESRRPSSPLIDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQ