McDonnell Genome Institute

Washington University

CircRNA

chr16|18819501|18842454|-|SMG1|ENST00000446231.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9742

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

ASQIMLSLQQR

Amino Acids from 5' Exons

EKLAALESSIEQRLKWAGGANPALAPVLQDFEATIAERRNLVLKESQRASQ,RSLHLNQVLNSDSSGQVVPTLHWPLYYKILKQRLKEEILSLKRAKEQV,EASCTIKYTATQVGRWCQPCIGPCTTRFSNDSKKKSCPREPKSKS

Amino Acids from 3' Exons

IMLSLQQRAQKRASYILRLEEISPWLAAMTNTEIALPGEVSARDTVTIHSVGGTITILPTKTKPKKLLFLGSDGKSYPYLFK,CVCNREHRNVQVTSCVLKKSVHGWLPLTLKLLFLGKSQPETLSQSIVWAEPSQSYRLKPSQRNFSFLDQMGRAILIFSK,NAKFATESTETCKLHLASRNQSMVGCHDHNCSSWGSLSQRHCHNPCGRNHHNLTDNQAKETSLSWIRWEELSLSFQ