McDonnell Genome Institute

Washington University

CircRNA

chr16|16086823|16090588|+|ABCC1|ENST00000399408.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9978

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

TGVNLSGGQK

Amino Acids from 5' Exons

GVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNK,ATCLGARSSAAWPGPCTPTLTFTSSMIPSQQWMPMWENTSLKMLAPRGCRT,REPVWGPEAAREPGPGRVLQRHLPLRSPLSSGCPCGKTHLKCDWPQGDAEEQ

Amino Acids from 3' Exons

TRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEEN,RGSWSRTAATCRRWTSSSSVAARSLRWAPTRSCWLETAPSLSSCVPMPAQSRSRMQRRT,ADLGHAQHELLAAGGRHHRHEWRQDLDGLLPGAAGSRRRLRVPAYLCQHRAGAGCRGE