McDonnell Genome Institute

Washington University

CircRNA

chr16|16056091|16068302|+|ABCC1|ENST00000399408.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9216

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

15

Peptide

FPLNILPMVISSIVQVAHMK

Amino Acids from 5' Exons

VAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFL,WPTRAKTIGSSTKFSMGSKCSFMPGSWHSRTRCWPSGRRSRCRSLPTCQPWAPSPGSARPF,GPHEEQRQSDQADERNSQWDQSAKALCLGAGIQGQGAGHQAGGAEGAEEVCLPVSRGHLHLGLHALS

Amino Acids from 3' Exons

VALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQ,WPCAHLPSTPLTRTTSWMPRQPSCLWPCSTSSGFPTFSPWSSAASC,GLVHICRLRDHREQHPGCPDSLRVFGLVQHPPVSPEHSPHGHQQHRA