McDonnell Genome Institute

Washington University

CircRNA

chr16|16044449|16046013|+|ABCC1|ENST00000399408.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9664

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

8

Peptide

LSLGLSIGRQPVK

Amino Acids from 5' Exons

AAGEGCVLLQGSCPAEREFQGGCEGGGGFDRQVPTEGVEPLSVGVIQDLWALLPHELLLQGHPRPDDVFRAADLK,QPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQIL,SRRLCTPPRILPSRKRVPRWMRMRRWRLSSSPHRRSGTPLCLRCYTRPLGPTSSASSSRPSTTCFPGRRS

Amino Acids from 3' Exons

VAHQVREHEGPRLAGLLLHRAAVCHCLPADPRAAPVLPHLLRQWHEDQDRCHWGCLSE,LLIKFVNDTKAPDWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRK,CSSSSMTRRPQTGRATSTPCCCLSLPACRPSCCTSTSTSASSVAGSRPLSLGLSIG