McDonnell Genome Institute

Washington University

CircRNA

chr16|15757826|15759728|-|MYH11|ENST00000300036.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9951

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

24

10

Peptide

EGIEWNFIDFGLDLQPCIELIERPADFAVEALAK

Amino Acids from 5' Exons

VNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERP,TPSSSCASTTPTRSCSSSSTTPCSSWSRRSTSARASSGTSSTLGWTYSPASSSSSD,ELLRAAVHQLHQREAAAALQPHHVHPGAGGVPARGHRVELHRLWAGPTALHRAHRAT

Amino Acids from 3' Exons

ADFAVEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFE,LTLLRLWPRQHMSAFSAGYSPATKPWTRPIGKGLPSWGSWILDLRSL,LCCRGFGQGNIAPFPLDTHPREQSPGQDPSARGFLPGDPGYSWIDL