McDonnell Genome Institute

Washington University

CircRNA

chr16|15735365|15753508|-|MYH11|ENST00000300036.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9857

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

5

Peptide

TELEDTLDSTATQQELRWTIMR

Amino Acids from 5' Exons

ARNRSEEQCPEEDPGAGGPHLRPPGGPGLRAGRQEQGKAEARPRRGAGGPKDRAGRHTGQHSHSAGAQ,LDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQEL,LTMKSLRRTMPRRSGSWRATSQTSRRTWTQSGPPGTRLKSRSETSARSWRPRQSWKTHWTAQPLSRSS

Amino Acids from 3' Exons

VDYNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKD,WTIMRVPGPRIWTRMTTLPCSMPPPTSLWPTCGRT,GLCECLADQEYGPAEQRDFPAQCLLRQVCGRPVEG