McDonnell Genome Institute

Washington University

CircRNA

chr16|15726847|15756514|-|MYH11|ENST00000300036.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9434

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

18

Peptide

LQNNPPGVLALLDEECWFPK

Amino Acids from 5' Exons

AKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQ,PRRTTRISRRWRKRTQTWPGSCGSWARPSRRWNIRRRSWRRRCRSCSPSAAMGSGPGRSSMTKSTSC,QGEPRQEADAGERERRPGRGAAGPGPGQAGGGTEEEAGGAGAGAAVQVQRWGAGPGGAQQSPQAA

Amino Acids from 3' Exons

NNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHYAGK,TTLQVCWPCWTRNAGSPKPRTSLSWRSCARSRAATPSSRSPSSSRTRLSSPSSIMLG,QPSRCAGPAGRGMLVPQSHGQVFRGEAVHGAGQPPQVPEAQAAQGQDVLHHPLCWE