McDonnell Genome Institute

Washington University

CircRNA

chr16|15687374|15696860|+|NDE1|ENST00000342673.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9288

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

GATIMSLEDFEQR

Amino Acids from 5' Exons

RHDHVSRRLAALESGHRKKCLPGKTKRESPGICSETEGSQ,ATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEAR,PRSCLSKTLSSAIRPSKEMPSWKVNLMKKRISWNLFRDRMKPE

Amino Acids from 3' Exons

ALESKLASCRNLVYDQSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDK,HWSPNSLPAGTSCTISPQTEQVAQPLGGAARTEMAGRDGQAAPACLWVIR,TGVQTRFLPEPRVRSVPKPNRWPSLWAEQQEQRWRGETAKQHQRAFGG