McDonnell Genome Institute

Washington University

CircRNA

chr16|15601990|15617535|-|KIAA0430|ENST00000396368.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9765

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

11

Peptide

TYGHSSVEELLGAIPQVWTQVECVRSI

Amino Acids from 5' Exons

VFTNDKMEECVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQ,FSLMIRWKNVSSQVCICLQRMCGLYFILTTTSRFSFMSFPWPIPSMSEKLCSPRPTATAAWRSSWEQFH,FHDGRMCEAHKSVFVCKECAVFTSYLPLPADFPSVFHGLYQVCRRNSAAQDLRPQQRGGALGSNST

Amino Acids from 3' Exons

VWTQVECVRSIINRHGRNPTRKRTAGVSPTQQSGPPEPLGVFPVTRRLLHELQPNYIRVRISRACLQTALFQGFQ,FGHKLNVSDLYKLTDTVAIREQGNGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHCSNKDF,LDTSMCQIYINQTRSQSVNKETDGWCVSYPAVRPARAPWGLPSHTTAPPRIAAQLYLKSNITSLSADSIVPIRIS