McDonnell Genome Institute

Washington University

CircRNA

chr16|11886776|11896785|-|GSPT1|ENST00000420576.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9454

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

16

Peptide

RVENGETEMSPEESWEHK

Amino Acids from 5' Exons

VISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNE,SQPGKESLKLDLKKEDRQENMQCWQRQQVNTLCLIRWMIQQIGAMR,NLSQERRVNWIKRRTDKRTCNVGKDSRCKTPNCANDGSNSKLEQE

Amino Acids from 3' Exons

KMERQKCLQKNHGSTKKKVKQSQGVVPWEMEGRQRKVPMKWRRKRKSQNLSLWLHRQVLLRKSMMYSLGT,RKWRDRNVSRRIMGAQRRNKSRARGWFLGRWKAARGKCPNDGGGRGNPKTVCGCTARCSERACKCSIHWAR,ENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHV