McDonnell Genome Institute

Washington University

CircRNA

chr16|11123741|11126146|+|CLEC16A|ENST00000409790.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.924

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

VPGHAGDWR

Amino Acids from 5' Exons

DMQVTGVEDDSRALNITIHKPASSPHSKPFPILQATFIFSDHIRCIIAKQRLAKGRIQARRMKMQRIA,TCRLAWRTTAVPTSPSTSLRPAPIPSPSPSSRPPSSSQTTSAASSPSSAWPKAASRQGARCREL,HAGDWRGGRQPCPEHHHPQACVQPPFQALPHPPGHLHLLRPHPLHHRQAAPGQRPHPGKAHEDAENS

Amino Acids from 3' Exons

PSWTSQSSPPLKSWGLDSAPPPPLSTCLSASTTRGAGAAATPQCSAPCLHRWTRCQ,PPGPPNPAHHSPGVWTRLLHLHSAPAFPLLRPGAPGQQRPHSAALRVCIGGQGA,LLDLPIQPTTEVLGFGLGSSTSTQHLPFRFYDQGRRGSSDPTVQRSVFASVDKVP