McDonnell Genome Institute

Washington University

CircRNA

chr15|98891324|98935426|+|IGF1R|ENST00000268035.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

TMSAATPSAWAAAAR

Amino Acids from 5' Exons

CAQARVGSGRAPRTMSAATPSAWAAAARLTTTRPVLAATTTMPVSVCLPARPTPTGLRAGAVWTVTSAPTSSAPRAATPRGLSTTASACRSAPRASSATAAR,VPKHVWEAGVHREQVLPPRVPGQLQRAQRHGLCSLPPLLLCRCLCACLPAQHLQVGLALCGPLLRQHPQRREQRLRGVCDPRRRVHAGVPLGLHPQRQPE,CPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQ

Amino Acids from 3' Exons

VRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEME,CDCWVWCPKASQHWSSWNHGAISKVISGLGQKW,AIAGCGVPRPANTGHHGTDDTGRSQKLSPVSEARNG